网站快照
 

    Khasiat QnC Jelly Gamat Sesungguhnya dan Bukti Testimoni Nyata

 
  • 关键词:
  • 该站未曾设置keywords
 
  • 页面描述:
  • Khasiat QnC Jelly Gamat Sesungguhnya dan Bukti Testimoni Nyata Anda masih ragu mengkonsumsi QnC Jelly Gamat atau Anda belum mengetahui bagaimana khasiat QnC
 
 
  • 蜘蛛模拟抓取:
  •     KhasiatQnCJellyGamatSesungguhnyadanBuktiTestimoniNyataSkiptocontentKhasiatQnCJellyGamatManfaatKhasiatQnCJellyGamatOriginalKhasiatQnCJellyGamatKhasiatQnCJellyGamatSesungguhnyadanBuktiTestimoniNyataAndamasihragumengkonsumsiQnCJellyGamatatauAndabelummengetahuibagaimanakhasiatQnCJellyGamatsesungguhnya??SarankamisebaiknyasimakulasanberikutdansegerakonsumsiQnCJellyGamatsecepatnyasertajanganlupauntukmemesannyakepadakamidiwebsiteini.KhasiatQnCJellyGamatSesungguhnyadanBuktiTestimoniNyataSebelummembahasbagaimanakhasiatQnCJellyGamatsesungguhnya,alangkahbaiknyaAndaketahuiduluQnCJellyGamatituproduksepertiapa,produsennyasiapadanapasajakomposisinya.QnCJellyGamat–ProdukKesehatanBerkhasiatTinggiDariOlahanTeripangEmasQnCJellyGamatadalahsalahsatuproduktradisionalberbentukcairanagakkentalsepertijelataujeli(bukankapsul,puyerataupuntablet),terbuatdariolahanteripang/gamatemasyangdikemaslebihmodern,praktis,dandenganmutuyangberkualitas.QnCJellyGamatdiproduksiolehCVJogjaNaturalHerbal?salahsatuperusahaanfarmasiterkemukadiIndonesiayangmemproduksiberbagaijenisprodukkesehatanberkualitassalahsatuprodukunggulannyaialahQnCJellyGamat.DanQnCJellyGamatsudahberlegalitasresmidenganterdaftardiDEPKESP-IRTNo:109321601291-1229DanBPOMPOMTR173301471?selainitujugaQnCJellyGamatpuntelahmendapatkansertifikasiHALALdariMUIIndonesia,Andatidakperluraguakankeamanannyakarenasudahberlegalitasresmi.KomposisiQnCJellyGamat100%AlamiKomposisitersebutantaralain:100%EkstrakTeripangEmasPengemulsiNabatiSweetenerSteviaAirROEssenNaturalEkstrakBuahSayurQnCJellyGamatmenggunakanbahan-bahanyang100%alamimulaidaribahanutamanya,pengawet,pembentuktekturdanpenyesuaianrasaberasaldaribuahdansayur.Teripangemasyangdigunakanpundenganstandarolahuntukpengobatanyaitufres,besardenganwarnahasilextrasiyangsama.TeripangyangdipakaiberasaldariperaianSulawesi,BangkaBelitungdanManado.Waktuyangdiperlukandaritempatteripangdiambilketempatproduksihanya1harisajajadifres(kesegaran)teripangmasihterjaga.SementaraitupenggunaanSweeternerstevia,pengemulsinabati,essennatural,buahdansayurdipilihuntukmenghindaripemakaianobatkimiayangberbahaya.Dimanafungsinyauntukmelembutkan,menghilangakanbauamis,membentuktekstur,danrasasehinggaprodukinibenar-benar100%alamidanmudahjugauntukdikonsumsi.KhasiatQnCJellyGamatSesungguhnyaKhasiatQnCJellyGamattidaklepasdaribahanutamanyayaituteripang/gamatemas,teripangemasmemilikiberbagaijeniskandungansenyawaaktifyangsangatbaikuntukpengobatanberbagaipenyakit.TeripangdalamB.Indonesia/gamatdalamB.Melayuadalahhewanyangbergeraklambat,hiduppadadasarsubstratpasir,lumpurpasiranmaupundalamlingkunganterumbu.Teripangmerupakankomponenpentingdalamrantaimakananditerumbukarangdanekosistemasosiasinyapadaberbagaitingkatstrukturpakan(trophiclevels).Teripangberperanpentingsebagaipemakandeposit(depositfeeder)danpemakansuspensi(suspensifeeder).Diberbagaibelahanduniaterdapatpopulasiteripangnamundenganjumlahdanjenisnyayangberbeda-beda,diIndonesiasendiridenganlautannyayangmembentangluasdianugerahiberbagaijenisteripangdenganjumlahyangsangatbanyak.Dariberbagaijenisteripangsalahsatuteripangyangseringdijadikansebagaipengobatanadalahteripang/gamatemas,jelasitudisebabkankarenakandungannyayangbanyakdankhasiatyangsudahterbuktiuntukberbagaipengobatan.Gbr.Teripang/GamatEmasBerikutkandungansenyawaaktifpadateripangemasQnCJellyGamat:Protein86,8%Kolagen80,0%MineralMukopolisakaridaGlucasaminoglycans(GAGs)AntiseptikalamiahGlucosaminedanChondroitinSaponinOmega-3,6,dan9AsamAminoLektinGamapeptideSumbervitaminsepertivitaminA,B1,B2,B3danC,Kalsium,Besi,Magnesium,ZengdllQnCJellyGamatadalahobatmultikhasiatyanghampirsemuajenispenyakitdapatdiobatinyamulaidaripenyakitluarsampaipenyakitdalam,mulaidaripenyakitkronishingganonkronisdengancarakerjayangberbeda-beda.SalahsatuungkapantersebutdiutarakanolehDrZenDjajaMD,salahsatudokterdiRumahSakitUmumMalang,JawaTimurmenuturkanteripangberkhasiatuntukhampirsemuakasuspenyakit.Carakerjanyatentusajaberbedamisalnyauntukasamuratekstrakteripangmemblokirasamurat,untukosteoarthritisaliasradangsenditeripangmemberikanchondroitinsehinggatulangrawannyamembaik.ItuungkapandariDr.ZenDjajaMDyangmenyebutkanbahwateripanginisangatberkhasiatuntuksegalapenyakitdengancarayangberbeda-beda(perludigarisbawahidengancaradankandungannyayangberbeda),itulahsebabnyamengapaQnCJellyGamatQnCbanyakyangmenyebutnyaobatserbaguna/obatmultikhasiat.KhasiatQnCjellyGamatdapatmengobatiberbagaipenyakit,diantaranyaseperti:Alzheimer,AsamUrat,AsamLambungAnoreksiaNervosaAlergi,AnginDudukAsma,Anemia,Autis,BatukBerdarah,BatukKering,BatukPadaBayiBronkitis,Bintitan,Bell’sPalsyBiduran,BatuGinjal,BatuEmpeduBopeng,Bulimia,ButaWarnaCampak,Cegukan,ChikungunyaCacarAir,CacarkeringDemam,Disentri,DiabetesEpilepsi/Ayan,FilariasisGonore,HepatitisA,HepatitisB,HepatitisCHidrosefalus,HaidTidakLancar/tidakteratur,HipertensiJerawat,Bopeng,Keloid,LukaBekasOperasi,LukaBakarKeputihan,KonstipasiatauSembelitMaagbaikAkutataupunKronisNyeriPinggang,SinusitisPolip,Polio,RadangSendiPanu,Kadas,Kurap,PenyakitJamuran,PenurunKolesterolTinggiReumatik,MiomaUteriDanberbagaipenyakitlainnyamulaidaripenyakitdalamhinggapenyakitluar(penyakitkulit),baikpenyakitkronisataupunnon-kronis.BerikutfaktakhasiatQnCJellyGamatsesungguhnyaberdasarkanparapenelitimulaidaridoktersampaiprofesorterkemukadiIndonesiadanMalaysia.DrOetjoengHandajantoSukajadi,beliauadalahsalahseorangahlipenelitianyangberasaldariBandung,Indonesia.PerkenalandrOetjoengHandajantodenganteripangpada2004silam.Semulaiamenganggapekstrakteripanghanyasebagaisuplemen.Namunkemudian,ahliterapikolontersebutmemberikanekstrakteripangkepadapenderitagangrenataulukadiabetesmelitus.Dandalamhitunganhari,lukayangdiberiekstrakteripangtersebutmengering.MenurutsalahsatululusanterbaikdariFakultasKedokteranBochumUniversity,Jerman,tersebutmeneruskanbahwakarenakeampuhanekstrakteripangyangkayakolagen.Faedahkolagenmembantumeningkatkanregenerasisel-selmatiakibatlukasehinggamempercepatpenyembuhan.Iatakmenyangkaekstrakitumampumenyembuhkanlukadalamwaktusingkat.Bagaimanadengandiabetesmelitus?Penyakitkencingmanisitupadadasarnyatidakbisadisembuhkan,tetapikadarguladarahhanyabisadikontrol.Itupunhanyapadapenderitadiabetesyangtidakmemilikiketergantunganinsulin.Nutrisididalamteripangmampumerangsangkelenjarpankreasuntukmemproduksiinsulinsecaraalami.SelainituanggotafamiliHolothuriidaeitumemperbaikikinerjaginjaldanlimfasehinggaguladapatdicernadenganbaik.Senyawaaktifitujugabergunauntukmengatasilukadindinglambungpenderitamaagakutdangangguanpencernaan.MenurutDr.Ir.AhkamSubroto,M.AppScdariLIPI.Menyatakan”Teripanglautmengandungproteintinggiyaknimencapai86,8%yangsangatbaikuntukdiberikanpadapenderitadiabetesmelitus.Proteintinggiberperanmeregenerasiselbetapankreasyangmemproduksiinsulin.Hasilnya,produksiinsulinpunmeningkat”.Prof.ZaitonHassandariUniversitasPutraMalaysiadanMAKaswandidariUniversitasKebangsaanMalaysia.Menyatakanbahwa”kandunganasamdocosahexanat(DHA)padateripangbisamenurunkantrigliseridadarahpenyebabpenyakitjantung.Halinitelahdibuktikanketikamenelitikandunganasamlemakteripanggoldenstichoupusvariegatus,hasilnyakandunganDHAteripangrelatiftinggi,yaitu3,69%.”Prof.Dr.RidzwanHashim,seorangahlipenelitidariUniversitasKebangsaanMalaysia,ikutmenyeruakanpendapatnyatentangpenelitianteripang,bahwasanya”Teripangmengandung86,8%protein,proteinteripangmudahdiuraikanolehenzimpepsin.Darijumlahitusekitar80,0%berupakolagenyangbergunasebagaipengikatjaringandalampertumbuhantulangdankulit.Dalampertumbuhantulang,suplemenkalsiumsajatidakcukup,lantarantulangterdiridarikalsiumfosfatdankolagensebagaipengisi.Tanpakolagentulangmenjadirapuhdanmudahpecahsepertikaca.Sebaliknya,jikatanpakalsium,tulangakankenyalsepertikaret.Untukitudiperlukankomposisiyangseimbang.”Prof.Dr.HassanYaakob,PhddariUniversitasMalaysia.Dalamsebuahpenelitiannyamenyebutkanbahwateripangdapatmeningkatkandayatahantubuh,mengurangirasasakitdangatalpadapermukaankulit,menurunkankadargula,menurunkankolesterol,merontokkanracunpadahati,menurunkantekanandarah,melancarkanperedarandarah,menyembuhkanpenyakitmaag,sertadapatmenyembuhkanasmakronis.Selainituteripangjugadapatdigunakanuntukbahanperawatankecantikandanpenyembuhlukabagiparaibuusaibersalin,karenakandunganproteindankolagenteripangyangsangattinggi.FaktadaripenelitiantersebutselarasdengantestimoninyataataukesaksiankonsumenkamiyangsudahmerasakankhasiatQnCJellyGamat,iniadalahbeberapatestimonikonsumenyangsudahmerasakanbetulkhasiatQnCJellyGamatSesungguhnyamulaidaripenyakitringanhinggapenyakitberatbaikkronisataupunnonkronis.TESTIMONIBATUGINJALAwalnyabpakseringbuangairkecilagak2tidaklancar,seringmengeluhpinggangsakitdaninisdhberlangsunglama,kamiseringmembawakedokteruntukcekupkatadokterbapaksakitasamurat.Atasinfoygsayabacadiinternetgamatbisamenjadisalahsatupengobatanalternatif,sayacobapesan2botoluntukdikomsumsibapak.Setelahhabis1botol,reaksiobatmenyebabkanbapakkencingdarahdalamseminggu,bapaksempatkhawatirkalauobatinitidakcocok,namunlewatberapaharisaatbapakmaubuangairkeciltiba2teriak,mamaygkagetdgteriakannyalarikekamarmandiuntukcekkeadaanbapak,ternyatabapakberusahamengeluarkanbaranganehsptbatu.Mamamengambilbaranganehitudanmengamatinyabentuknyasepertibatuygbergerigi.Lalumerekabergegaskedokteruntukkonsultasisekalianbawahbaranganehsepertibatuitu.Katadokteritubatuginjalygtelahberhasildikeluarkan,banyakyangsakitbatuginjalharusoperasitpbapakberhasilkasihkeluarlewatBAK.Banyakorangtidakpercayadanbapakmenunjukkanbotolsertaalamatpengirimsupayateman2bapakjgbisaikutkonsumsijellygamat.Syukurakhirnyabatuyangmengendapdiginjalbisadikeluarkanberkatjellygamatnya.TerimakasihJellygamatnya.UntukmengingatkankembalimengapaQnCJellyGamatbisasepertiitu,bisamultikhasiathampirsemuajenispenyakitdapatdiobatinya?ItukarenakandunganyangadadidalamteripangemasyangmenjadibahanutamaQnCJellyGamatmemilikikandunganberbagaijenissenyawaaktifdansepetiyangdijelaskanDr.ZenDjajaMDtaditeripangakanmengobatisuatupenyakitdengancaradankandungannyayangberbeda-beda.OlehsebabitumengapakamimenyarankanuntuksegeramengkonsumsiQnCJellyGamatkarenaterbuktidaritestimonikonsumenkamiyangsudahmerasakanbetulkhasiatdariQnCJellyGamatsepertiyangkamilampirkandiatas.Danjugaselainobatnyayangberkhasiattinggiuntukberbagaikeluhanpenyakitjugasangatamandikonsumsitanpaadaefeksampingapapunkarenaterbuatdari100%alamitanpacampuranbahankimiawisedikitpun.BerikutInformasiSingkatMengenaiProdukQnCJellyGamatNamaProdukQnCJellyGamatHargaRp.155.000,-(belibanyakadadiscount)Isi300ml/botol(Bentuknyacairanagakkentalsepertijel/jeli)KomposisiTeripangEmas,?SweetenerStevia,PengemulsiNabati,EssenNatural,EkstrakBuahdanSayurCaraKonsumsiUntukDewasa:Dikonsumsi2xsehari2sendokmakansebelummakanUntukAnakAnakdiatas5tahun:Dikonsumsi2xsehari1SendokmakansebelummakanUntukAnakAnakdibawah5tahun:Dikonsumsi2xsehari1-3sendoktehbukansendokmakanDioleskansecukupnyaterhadapkulityangluka,terasagatal,danterkenaberbagaipenyakitkulit.QnCJellyGamatherbaliniamandikonsumsiuntuksemuajenisusiadankondisi.DEPKESP-IRTNo:109321601291-1229ProdusenPT.BijaksanaMajuUtamaKodeProdukQNC(KodeprodukQNCharusselaluandacantumkandisaatakanmemesanObatHerbalQnCJellyGamatkepadakami)DaftarHargaResmiQnCJellyGamat(BelumTermasukOngkosKirim/Ongkir)*KeteranganKamimenyarankankepadaandauntukpesanyang4botol(untukPengobatan1bulan).Karenaselainbisamendapatkanhargayanglebihmurahdanhematongkir,Andamenjadilebihfokusdalammenjalanipengobatanherbalsesuaidosisyangtepattanpaharusterputus.Sehinggadapatlebihcepatdalamprosespenyembuhannya.BerminatinginmemesanQnCJellyGamat??Tidakperlumenunggulamasegeralakukanpemesanan,caramemesannyapunsangatmudahcukupSMSsaja(sekalilagicukupSMSsaja)denganmengirimkanformatpesanansepertidibawahini!!BerikutformatpesananygharusAndaketikdiSMS:QNC:JumlahPesanan:Nama:AlamatPengiriman:No.Hp/Teleponkirimke0823.2011.4649?.BerikutContohPemesanan2botol:?.QNC:2botol:UdinSaefudin:Jl.PerintisKemerdekaanNo.41Rt/Rw07/07kel.Setiajaya,Kec.Tawang,SumedangJawaBarat:085.323.201.XXXkirimke0823.2011.4649________________________________________________________________________PERHATIAN:KODE”QNC”adalahkodedariQnCJellyGamatUntukpemesanan?QnCJellyGamatKODE“QNC”harusdicantumkanuntukmencegahkekeliruandanagarpesanandapatkamiprosesdengancepat.________________________________________________________________________SetelahAndamengirimSMSpesanantsb,nantiCustomerServicekamiakanmembalasSMSitudenganmemberikanTotalHarga(TotalHarga=Jumlahprodukygdibeliongkoskirim),jikaAndaSEPAKAT/DEALbalasSMStsbdengankataSEPAKAT/DEAL,jikasudahdemikianpesananlangsungakankamiproses..UntukmenjagakenyamanansertakepercayaanAndakepadakami.MakakamimemberlakukansistemBARANGSAMPAI,BARUBAYAR(berlakuhanyauntukPemesanan1-2Botol).JadijikaAndamemesan1-2botolmakabarangkamikirimduludanbayarnyanantisetelahbarangsudahAndaterima,pembayaranviatransferrekeningbank.Sementaraitujikamemesandiatas2botol,makaandadiharuskanmentransferterlebihdahuluminimalsetengahnya(50%nya)dariTotalHargayangharusAndabayar,danAndadapatmelakukanpelunasannyasetelahobatygandapesansudahditerimadenganbaik.KAMIMENJAMINBARANGPASTISAMPAIDGBAIK,JIKABARANGTIDAKSAMPAI,UANGKAMIKEMBALIKAN100%..!!UntukmentransfernyaAndabisamenggunakanNo.Rekeningkamiberikutini:BankBRI4371unitSingaparnatimurNo.Rekening4371-01-000197-50-9AtasNama:SapnudinBankMandiriKCPTasikmalayaMustofaNo.Rekening:131-00-1034177-6AtasNama:SapnudinBankBCAKCUTasikmalayaNo.Rekening:054.063.9132AtasNama:SapnudinNah,JikaAndakebetulanberadadiwilayahkantorpelayanankamiyaitudi:Jl.NoenoengTisnaSaputra,SampingPerumahanWijayaPermai2,Kec.TawangKel.Kahuripan,KotaTasikmalaya,JawaBarat.BisamembelinyalangsungdenganmendatangialamatkantorkamiataubisajugamelakukanCOD(CashonDelivery)pesanankamiantarkealamattujuandanbayarditempat(khususjikaAndaberadadiwilayahTasikmalayadansekitarnya).DemikianinformasimengenaikhasiatQnCJellyGamatsesungguhnya,sudahsaatnyaAndasegerakonsumsiQnCJellyGamatdanjanganlupauntukmemesannyakapadakamidiwebsiteini.KhasiatQnCJellyGamatSesungguhnyadanBuktiTestimoniNyataAdminbersamaPengelola:SAPNUDINAlamat:Jl.NoenoengTisnaSaputra,SampingPerumahanWijayaPermai2,Kel.Kahuripan,Kec.Tawang,KotaTasikmalaya,JawaBaratKontakKami:DidaHerdianingsihNo.Telepon:UntukPemesanan085.221.330.085ObatAceMaxs0823.2011.4649QnCJellyGamat085.222.243.893ProdukGreenWorldDaftarHargaObatHerbal:AceMaxsPembelianDiscountTotalHarga1botol-Rp.240.0002botolRp.5.000Rp.475.0003botolRp.15.000Rp.705.0006botolRp.115.000Rp.1.325.000QnCJellyGamatPembelianDiscountTotalHarga1botolTidakAdaRp.155.0002botolTidakAdaRp.310.0004botolRp.20.000Rp.600.0005botolRp.30.000Rp.745.0007botolRp.50.000Rp.1.035.0009botolRp.95.000Rp.1.300.00012botolRp.160.000Rp.1.700.00020botolRp.300.000Rp.2.800.000DaftarHargaProdukGreenWorld:NamaProdukHargaCordycepsPlusCapsuleRp.310.500Pro-slimTeaRp.92.000PropolisPlusCapsuleRp.345.000GanodermaPlusCapsuleRp.396.000JianXinCapsuleRp.368.000KudingTeaRp.103.500Multi-VitaminChildTabletRp.109.000Multi-VitaminAdultTabletRp.258.000CalciumSoftgelRp.241.500ZincTabletForChildRp.109.000ZincTabletForAdultRp.247.000LecithinSoftgelRp.235.000DeepSeaFishOilSoftgelRp.270.000ChitosanCapsuleRp.264.500CompoundMarrowPowderRp.368.000Pro-CleansingTeaRp.86.000GinkgoBilobaPlusCapsuleRp.264.500SeTabletForChildRp.145.000SeTabletForAdultRp.116.000KidneyMenCapsuleRp.327.000KidneyWomenCapsuleRp.327.000SlimmingCapsuleRp.247.000KoloklinCapsuleRp.224.000DiasisCareCapsuleRp.253.000SuperCoQ-10CapsuleRp.368.000OPCPlusCapsuleRp.322.000BreastCareCapsuleRp.425.500TriflexCapsuleRp.378.000GastricHealthTabletRp.161.000ColostrumNutrientCapsuleRp.281.000HepatSureCapsuleRp.362.000SpirulinaPlusTabletRp.253.000OvaryNutritionCapsuleRp.345.000EyeCareSoftgelRp.442.000GlucoblockCapsuleRp.178.000Vig-PowerCapsuleRp.230.000SleepCareCapsuleRp.248.000BrainCareCapsuleRp.368.000LycopeneSoftgelRp.612.000ClearLungTeaRp.109.000No.RekeningPembayaran:No.Rekening:054.063.9132AtasNama:SapnudinNo.Rekening:131-00-1034177-6AtasNama:SapnudinNo.Rekening:4371-01-000197-50-9AtasNama:SapnudinSistemPengiriman:1.CashOnDelivery(COD)KamimelayanipengirimanCashonDelivery/COD(yaknilayananpengirimanprodukviakurir,pembayarandilakukansaatterimaproduk),untukwilayahtasikmalaya,ciamisdansekitarnya.2.PengirimanVIAJNE.BagiAndayangberadadiluarwilayahCashOnDelivery(COD)danbelumterdapatAgenResmikamidiwilayahAnda,makaprodukherbalyangandapesanakandikirimviaJNE.KamimerupakanpenjualObatHerbalyangtelahmelakukanpengirimankeberbagaipelosokwilayahIndonesia.KamisiapmengirimprodukherbalyangandapesankeseluruhkotadiIndonesiadengancepatdanmurah.Padaumumnyauntukkota-kotabesarprodukherbalakansampaidalamwaktu2-3hari,sedangkanuntukkota-kotapelosokmembutuhkanwaktupalinglambat3-5hari.MetaLoginEntriesRSSCommentsRSSWordPress.orgProudlypoweredbyWordPress|Theme:LontanoFreebyCrestaProjectWordPressThemes.error:
 
 
Copyright© 2004-2018 liequ.com All Rights Reserved 版权所有
暂无